PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g005680.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 267aa    MW: 29543.9 Da    PI: 5.8236
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g005680.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.63.7e-30146199155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Sopim06g005680.0.1 146 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 199
                         59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.175141202IPR017930Myb domain
SuperFamilySSF466891.16E-19143203IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-30145204IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23147199IPR006447Myb domain, plants
PfamPF002494.2E-8149198IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGEEVKITDG DGYAGDDNRV GEWEDGLPSF DDLTPLSQVL IPPELASAFR ITPEPAKTMT  60
DVNRASESTF SSLRAGQLHM LSEKYNFNEG RNGDRNHEND EMDLTRDGSE SRKTRRLDPE  120
MVTEEADSAL RNENCGDDNS AKTLKRPRLV WTPQLHKRFV DVVAHLGIKN AVPKTIMQLM  180
NVEGLTRENV ASHLQKYRLY LKRMQGLSNE GPSSSDHLFA STPVPQSLQQ SGGNGHSGNG  240
HSSNGHMPMP MPMPITWTWA RVSSSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-20145204463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2192130.0AC219213.1 Solanum lycopersicum chromosome 6 clone C06HBa0147H20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240372.10.0PREDICTED: transcription factor PCL1
SwissprotQ9SNB41e-85PCL1_ARATH; Transcription factor LUX
TrEMBLK4C3500.0K4C350_SOLLC; Uncharacterized protein
STRINGSolyc06g005680.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35802343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.23e-87G2-like family protein